SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ddzA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ddzA
Domain Number 1 Region: 5-189
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.89e-74
Family PH0223-like 0.0000000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ddzA   PDB: 2ddz
Sequence length 190
Comment (A:)
Sequence
MNSMELLIIKERRIDYDGSAIRSHWAYRNFGILGDSLVVFRGKCNVKVEEMVDIEDLRLR
KEIKGDDMVHYILELFWHPDILLASSLQKLLIARLVELLWNYGIEASRRGDDIYVNGRKL
SISIATVSPVSIKIHIGLNVKTVGVPPGVDAIGLEELGIDPTEFMERSAKALVEEIEKVR
KDSLKVRWVT
Download sequence
Identical sequences O57962
70601.PH0223 2ddzA pho001000223.1 d2ddze_ 2ddz_A 2ddz_B 2ddz_C 2ddz_D 2ddz_E 2ddz_F gi|14590154|ref|NP_142219.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]