SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2dekA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2dekA
Domain Number 1 Region: 1-262
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 3.98e-64
Family Tetrapyrrole methylase 0.000000000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2dekA   PDB: 2dek
Sequence length 265
Comment (A:)
Sequence
MVLYFIGLGLYDERDITVKGLEIAKKCDYVFAEFYTSLMAGTTLGRIQKLIGKEIRVLSR
EDVELNFENIVLPLAKENDVAFLTPGDPLVATTHAELRIRAKRAGVESYVIHAPSIYSAV
GITGLHIYKFGKSATVAYPEGNWFPTSYYDVIKENAERGLHTLLFLDIKAEKRMYMTANE
AMELLLKVEDMKKGGVFTDDTLVVVLARAGSLNPTIRAGYVKDLIREDFGDPPHILIVPG
KLHIVEAEYLVEIAGAPREILRVNV
Download sequence
Identical sequences O58456
d1vcea1 d1vceb_ d1wnga_ d1wngb_ d2deka_ d2dekb_ 70601.PH0725 WP_010884823.1.38245 pho001000725.1 pho001000725.2 pho001000725.45 1vce_A 1vce_B 1wng_A 1wng_B 2dek_A 2dek_B gi|14590602|ref|NP_142670.1| 2dekA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]