SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2djiA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2djiA
Domain Number 1 Region: 363-583
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.03e-54
Family Pyruvate oxidase and decarboxylase PP module 0.00000000181
Further Details:      
 
Domain Number 2 Region: 187-359
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 9.79e-42
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000000194
Further Details:      
 
Domain Number 3 Region: 3-174
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.68e-39
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2djiA   PDB: 2dji
Sequence length 590
Comment (A:)
Sequence
dnkiniglavmkileswgadtiygipsgtlsslmdamgeeennvkflqvkheevgamaav
mqskfggnlgvtvgsggpgashlinglydaamdnipvvailgsrpqrelnmdafqelnqn
pmydhiavynrrvayaeqlpklvdeaarmaiakrgvavlevpgdfakveidndqwyssan
slrkyapiapaaqdidaavellnnskrpviyagigtmghgpavqelarkikapvittgkn
fetfewdfealtgstyrvgwkpanetileadtvlfagsnfpfsevegtfrnvdnfiqidi
dpamlgkrhhadvailgdaalaideilnkvdaveesawwtanlknianwreyinmletke
egdlqfyqvynainnhadedaiysidvgnstqtsirhlhmtpknmwrtsplfatmgiaip
gglgakntypdrqvwniigdgafsmtypdvvtnvrynmpvinvvfsnteyafiknkyedt
nknlfgvdftdvdyakiaeaqgakgftvsriedmdrvmaeavaankaghtvvidckitqd
rpipvetlkldsklysedeikaykeryeaanlvpfreyleaegleskyik
Download sequence
Identical sequences 2djiA 1v5e_A 2dji_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]