SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2e1bA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2e1bA
Domain Number 1 Region: 88-214
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.07e-34
Family AlaX-like 0.000000219
Further Details:      
 
Domain Number 2 Region: 2-87
Classification Level Classification E-value
Superfamily Translation proteins 4.3e-22
Family AlaX-M N-terminal domain-like 0.0000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2e1bA   PDB: 2e1b
Sequence length 216
Comment (A:)
Sequence
MINMTRKLYYEDAYLKEAKGRVLEIRDNAILLDQTIFYPTGGGQPHDRGTINGVEVLDVY
KDEEGNVWHVVKEPEKFKVGDEVELKIDWDYRYKLMRIHTGLHLLEHVLNEVLGEGNWQL
VGSGMSVEKGRYDIAYPENLNKYKEQIISLFNKYVDEGGEVKIWWEGDRRYTQIRDFEVI
PCGGTHVKDIKEIGHIKKLKRSSIGRGKQRLEMWLE
Download sequence
Identical sequences O57848
APC28547 pho001000108.1 2e1bA 2e1b_A gi|14590056|ref|NP_142120.1| 70601.PH0108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]