SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2e1oA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2e1oA
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily Homeodomain-like 4.46e-27
Family Homeodomain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2e1oA   PDB: 2e1o
Sequence length 70
Comment (A:)
Sequence
gssgssgkggqvrfsndqtielekkfetqkylspperkrlakmlqlserqvktwfqnrra
kwrrsgpssg
Download sequence
Identical sequences 2e1o_A 2e1oA 001159982|e2e1oA2|101.1.1.10|A:1-70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]