SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2e9xC from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2e9xC
Domain Number 1 Region: 91-194
Classification Level Classification E-value
Superfamily GINS helical bundle-like 2.05e-33
Family PSF3 C-terminal domain-like 0.00000074
Further Details:      
 
Domain Number 2 Region: 4-89
Classification Level Classification E-value
Superfamily PriA/YqbF domain 1.35e-22
Family PSF3 N-terminal domain-like 0.0000085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2e9xC   PDB: 2e9x
Sequence length 219
Comment (C:)
Sequence
gphmseayfrvesgalgpeenflslddilmsheklpvrtetamprlgafflersagaetd
navpqgsklelplwlakglfdnkrrilsvelpkiyqegwrtvfsadpnvvdlhkmgphfy
gfgsqllhfdspenadisqsllqtfigrfrrimdssqnaynedtsalvarldemerglfq
tgqkglndfqcwekgqasqitasnlvqnykkrkftdmed
Download sequence
Identical sequences 2e9xC 2e9x_C 2e9x_G

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]