SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ebfX from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ebfX
Domain Number 1 Region: 555-746
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.71e-125
Family PMT C-terminal domain like 0.00000000449
Further Details:      
 
Domain Number 2 Region: 38-333
Classification Level Classification E-value
Superfamily PMT central region-like 4.98e-114
Family PMT central region-like 0.0000000000297
Further Details:      
 
Domain Number 3 Region: 336-553
Classification Level Classification E-value
Superfamily EreA/ChaN-like 1.23e-76
Family PMT domain-like 0.00000000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ebfX   PDB: 2ebf
Sequence length 746
Comment (X:)
Sequence
mghhhhhhdydipttenlyfqgahmgiqrvsnakllggspyspfriglegvwtpevlkar
asvigkpigesykrilaklqrihnsnilderqglmhelmelidlyeesqpsserlnafre
lrtqlekalylpemealkkqilqipnkgsgaarfllrtamnemagktsestadlirfalq
dtvisapfrgyagaipeaidfpvkyviedisvfdkiqtnywelpayeswnegsnsallpg
llresqskgmlskcriienslyighsyeemfysispysnqvggpyelypftffsmlqevq
gdlgfeqafatrnffntlvsdrlslmentmlltesfdytpwdaiygdinydeqfaamsin
eriekcmntyrgvafqnssksidfflnnlttfidnglteiaisdlpydivqqeisqflqg
snewktldamlfnldkgdingafrkllqsakdnnikfraighsdnsvppfnnpykslyyk
gniiaeaiekldregqkfvvfadssllnstpgtgrpmpglvqylkipatvvdsdgawqfl
pdvassrvpievtelenwqvltppqgkilglkqfkltagfpteqsrlpllensvsedlre
elmqkidaikndvkmnslvcmeagscdsvspkvaarlkdmgleagmgasitwwrreggme
fshqmhttasfkfagkefavdashlqfvhdqldttililpvddwaleiaqrnrainpfve
yvsktgnmlalfmpplftkprltral
Download sequence
Identical sequences 2ebfX 2ebf_X

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]