SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ehoB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ehoB
Domain Number 1 Region: 2-145
Classification Level Classification E-value
Superfamily GINS helical bundle-like 2.4e-50
Family PSF1 N-terminal domain-like 0.000000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ehoB   PDB: 2eho
Sequence length 152
Comment (B:)
Sequence
mmfcekamelirelhrapegqlpafnedglrqvleemkalyeqnqsdvneaksggrsdli
ptikfrhcsllrnrrctvaylydrllriralrweygsilpnalrfhmaaeemewfnnykr
slatymrslggdeglditqdmkppkslyievr
Download sequence
Identical sequences 2ehoB 2eho_B 2eho_F 2eho_J

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]