SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2el9A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2el9A
Domain Number 1 Region: 12-325
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.89e-106
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000000147
Further Details:      
 
Domain Number 2 Region: 336-430
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.2e-25
Family Anticodon-binding domain of Class II aaRS 0.0000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2el9A   PDB: 2el9
Sequence length 431
Comment (A:)
Sequence
gpgyqdpmakniqairgmndylpgetaiwqriegtlknvlgsygyseirlpiveqtplfk
raigevtdvvekemytfedrngdsltlrpegtagcvragiehgllynqeqrlwyigpmfr
herpqkgryrqfhqlgcevfglqgpdidaelimltarwwralgisehvtlelnsigslea
ranyrdalvafleqhkekldedckrrmytnplrvldsknpevqallndapalgdyldees
rehfaglckllesagiaytvnqrlvrgldyynrtvfewvtnslgsqgtvcaggrydglve
qlggratpavgfamglerlvllvqavnpefkadpvvdiylvasgadtqsaamalaerlrd
elpgvklmtnhgggnfkkqfaradkwgarvavvlgesevangtavvkdlrsgeqtavaqd
svaahlrtllg
Download sequence
Identical sequences 2el9A 2el9_A 2el9_B 2el9_C 2el9_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]