SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2es7A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2es7A
Domain Number 1 Region: 5-127
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.22e-23
Family HyaE-like 0.000000701
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2es7A   PDB: 2es7
Sequence length 142
Comment (A:)
Sequence
mandtpfsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiae
llrefpqfdwqvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlm
rsivdtpaaqetvqlehhhhhh
Download sequence
Identical sequences 000336465|e2jztA1|2485.1.1.26|A:1-142 2es7A 2es7_A 2es7_B 2es7_C 2es7_D 2gzp_A 2jzt_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]