SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2etfA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2etfA
Domain Number 1 Region: 2-440
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.62e-181
Family Clostridium neurotoxins, catalytic domain 0.00000000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2etfA   PDB: 2etf
Sequence length 441
Comment (A:)
Sequence
mpvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfn
kssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylg
drrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnh
fasregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhgly
gikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgiv
drlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetn
iaenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqa
yeeiskehlavykiqmcksvk
Download sequence
Identical sequences 2etfA 2etf_A 2etf_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]