SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2eyqA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2eyqA
Domain Number 1 Region: 13-346
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.98e-100
Family Tandem AAA-ATPase domain 0.00000000000508
Further Details:      
 
Domain Number 2 Region: 523-783
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.79e-64
Family Tandem AAA-ATPase domain 0.00000000266
Further Details:      
 
Domain Number 3 Region: 782-990
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.67e-49
Family Tandem AAA-ATPase domain 0.00000000745
Further Details:      
 
Domain Number 4 Region: 995-1147
Classification Level Classification E-value
Superfamily TRCF domain-like 1.61e-44
Family TRCF domain 0.0000000473
Further Details:      
 
Domain Number 5 Region: 354-466
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.57e-27
Family Tandem AAA-ATPase domain 0.00000107
Further Details:      
 
Domain Number 6 Region: 470-548
Classification Level Classification E-value
Superfamily CarD-like 1.54e-23
Family CarD-like 0.00000574
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2eyqA   PDB: 2eyq
Sequence length 1151
Comment (A:)
Sequence
gphmpeqyrytlpvkageqrllgeltgaacatlvaeiaerhagpvvliapdmqnalrlhd
eisqftdqmvmnladwetlpydsfsphqdiissrlstlyqlptmqrgvlivpvntlmqrv
cphsflhghalvmkkgqrlsrdalrtqldsagyrhvdqvmehgeyatrgalldlfpmgse
lpyrldffddeidslrvfdvdsqrtleeveainllpahefptdkaaielfrsqwrdtfev
krdpehiyqqvskgtlpagieywqplffseplpplfsyfpantllvntgdletsaerfqa
dtlarfenrgvdpmrpllppqslwlrvdelfselknwprvqlktehlptkaananlgfqk
lpdlavqaqqkapldalrkfletfdgpvvfsvesegrrealgellarikiapqrimrlde
asdrgrylmigaaehgfvdtvrnlalicesdllgervarrrqdsrrtinpdtlirnlael
higqpvvhlehgvgryagmttleaggitgeylmltyandaklyvpvsslhlisryaggae
enaplhklggdawsrarqkaaekvrdvaaelldiyaqraakegfafkhdreqyqlfcdsf
pfettpdqaqainavlsdmcqplamdrlvcgdvgfgktevamraaflavdnhkqvavlvp
ttllaqqhydnfrdrfanwpvriemisrfrsakeqtqilaevaegkidiligthkllqsd
vkfkdlgllivdeehrfgvrhkerikamranvdiltltatpiprtlnmamsgmrdlsiia
tpparrlavktfvreydsmvvreailreilrggqvyylyndveniqkaaerlaelvpear
iaighgqmrerelervmndfhhqrfnvlvcttiietgidiptantiiieradhfglaqlh
qlrgrvgrshhqayawlltphpkamttdaqkrleaiasledlgagfalathdleirgage
llgeeqsgsmetigfslymellenavdalkagrepsledltsqqtevelrmpsllpddfi
pdvntrlsfykriasakteneleeikvelidrfgllpdpartlldiarlrqqaqklgirk
legnekggviefaeknhvnpawligllqkqpqhyrldgptrlkfiqdlserktriewvrq
fmreleenaia
Download sequence
Identical sequences 2eyqA 2eyq_A 2eyq_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]