SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2eziA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2eziA
Domain Number 1 Region: 1-75
Classification Level Classification E-value
Superfamily Homeodomain-like 5.61e-33
Family Recombinase DNA-binding domain 0.00000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2eziA   PDB: 2ezi   SUPERFAMILY: 2eziA
Sequence length 75
Comment (A:)
Sequence
mnvhksefdedawqfliadylrpekpafrkcyerlelaarehgwsipsratafrriqqld
eamvvacregehalm
Download sequence
Identical sequences 2eziA 000002479|e2eziA1|101.1.1.31|A:1-75 cath|current|2ezhA00/178-242 cath|current|2eziA00/173-247 d2ezia_ 2ezh_A 2ezi_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]