SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2f2lA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2f2lA
Domain Number 1 Region: 2-167
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 9.52e-46
Family N-acetylmuramoyl-L-alanine amidase-like 0.00000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2f2lA   PDB: 2f2l
Sequence length 167
Comment (A:)
Sequence
dfverqqwlaqppqkeipdlelpvglvialptnsencstqaicvlrvrllqtydiessqk
cdiaynfliggdgnvyvgrgwnkmgahmnninydsqslsfayigsfktiqpsakqlsvtr
lllergvklgkiapsyrftassklmpsvtdfkadalyasfanwthws
Download sequence
Identical sequences 1z6i_A 2f2l_A 2f2lA 001903999|e1z6iA1|285.1.1.1|A:1-167 cath|current|1z6iA00/354-520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]