SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2f2lX from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2f2lX
Domain Number 1 Region: 7-163
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 3.74e-69
Family N-acetylmuramoyl-L-alanine amidase-like 0.00000787
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2f2lX   PDB: 2f2l
Sequence length 167
Comment (X:)
Sequence
mvilkvaewggrpakrmldaqqlpinrvvishtaaegcesrevcsarvnvvqsfhmdswg
wdhigynflvggdgrvyegrgwdyvgahtkgynrgsigisfigtfttrkpnerqleacql
llqegvrlkklttnyrlyghrqlsatespgeelykiikkwphwshei
Download sequence
Identical sequences 2f2l_X 2f2lX cath|current|2f2lX00/334-499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]