SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2fmrA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2fmrA
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000599
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2fmrA   PDB: 2fmr   SUPERFAMILY: 2fmrA
Sequence length 65
Comment (A:)
Sequence
asrfheqfivredlmglaigthganiqqarkvpgvtaidldedtctfhiygedqdavkka
rsfle
Download sequence
Identical sequences 2fmrA 2fmr_A 000070795|e2fmrA1|327.11.2.10|A:1-65 cath|current|2fmrA00/1-65 d2fmra_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]