SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2fn3A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2fn3A
Domain Number 1 Region: 183-341
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 8.35e-62
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000000891
Further Details:      
 
Domain Number 2 Region: 352-523
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.06e-51
Family Pyruvate oxidase and decarboxylase PP module 0.0000000477
Further Details:      
 
Domain Number 3 Region: 7-172
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.17e-40
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000000493
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2fn3A   PDB: 2fn3
Sequence length 528
Comment (A:)
Sequence
masvhgttyellrrqgidtvfgnpganelpflkdfpedfryilalqeacvvgiadgyaqa
srkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlpr
plvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvs
ssvrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprc
pfptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtc
dpleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfd
tlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeper
qviavigdgsanysisalwtaaqyniptifvimnngtygalrwfagvleaenvpgldvpg
idfralakgygvqalkadnleqlkgslqealsakgpvlievstvspvk
Download sequence
Identical sequences 2fn3_A 2fn3A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]