SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2fnjC from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2fnjC
Domain Number 1 Region: 2-96
Classification Level Classification E-value
Superfamily POZ domain 4.22e-38
Family BTB/POZ domain 0.00000663
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2fnjC   PDB: 2fnj
Sequence length 96
Comment (C:)
Sequence
MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMY
FTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Download sequence
Identical sequences A0A060YZI5 A0A2G9R7S5 A0A2I3GHI4 A0A2J8M9T5 A0A2J8VA40 A0A2K5ZZI2 F6QV73 L5LNB4 L9LE26
ENSP00000430224 ENSMODP00000008638 1lm8_C 1lqb_B 2fnj_C 2jz3_C 3zkj_B 3zkj_E 4n9f_5 4n9f_B 4n9f_E 4n9f_K 4n9f_Q 4n9f_T 4n9f_Y 4n9f_Z 4n9f_h 4n9f_n 4n9f_t 4n9f_z 4wqo_C 6bvb_C 6c5x_C 6c5x_F 000072850|e1vcbH1|226.1.1.6|H:17-112 000072851|e1lqbB1|226.1.1.6|B:1-96 000072852|e1vcbK1|226.1.1.6|K:17-112 000072853|e1vcbE1|226.1.1.6|E:17-112 000072854|e2izvC1|226.1.1.6|C:2-97 000072855|e2fnjC1|226.1.1.6|C:1-96 000072856|e1vcbB1|226.1.1.6|B:17-112 000072857|e3dcgB1|226.1.1.6|B:2-97 000072858|e3dcgD1|226.1.1.6|D:2-97 000072859|e1lm8C1|226.1.1.6|C:1-96 000072860|e2jz3C1|226.1.1.6|C:1-96 000148510|e3zrcB1|226.1.1.6|B:2-97 000151443|e3ztcB1|226.1.1.6|B:2-97 000153309|e4b95B1|226.1.1.6|B:2-97 000153758|e4ajyC1|226.1.1.6|C:2-97 001177333|e3zunB2|226.1.1.6|B:2-97 001177334|e3zrfB2|226.1.1.6|B:2-97 001177335|e3ztdB2|226.1.1.6|B:2-97 001177336|e3ztdE2|226.1.1.6|E:2-97 001177337|e3zrcE2|226.1.1.6|E:2-97 001177338|e4b95E2|226.1.1.6|E:2-97 001177339|e3zunE2|226.1.1.6|E:2-97 001177340|e3zrfE2|226.1.1.6|E:2-97 001177341|e3ztcE2|226.1.1.6|E:2-97 001177342|e4b95H2|226.1.1.6|H:2-97 001177343|e3zunH2|226.1.1.6|H:2-97 001177344|e3ztcK2|226.1.1.6|K:2-97 001177345|e3ztdK2|226.1.1.6|K:2-97 001177347|e3zunK2|226.1.1.6|K:2-97 001177348|e3zrcH2|226.1.1.6|H:2-97 001177350|e4b9kE2|226.1.1.6|E:2-97 001177351|e3ztcH2|226.1.1.6|H:2-97 001177352|e3ztdH2|226.1.1.6|H:2-97 001177353|e3zrfH2|226.1.1.6|H:2-97 001177354|e3zrcK2|226.1.1.6|K:2-97 001177355|e3zrfK2|226.1.1.6|K:2-97 001177356|e4b9kH2|226.1.1.6|H:2-97 001177358|e4awjB2|226.1.1.6|B:2-97 001177359|e4awjH2|226.1.1.6|H:2-97 001177360|e4awjE2|226.1.1.6|E:2-97 001280809|e4bksB1|226.1.1.6|B:2-97 001280810|e4bksE1|226.1.1.6|E:2-97 001280811|e4bksH1|226.1.1.6|H:2-97 001280813|e4bktB1|226.1.1.6|B:2-97 001280814|e4bktE1|226.1.1.6|E:2-97 001280815|e4bktH1|226.1.1.6|H:2-97 001349217|e4w9cB1|226.1.1.6|B:2-97 001349218|e4w9cE1|226.1.1.6|E:2-97 001349219|e4w9cH1|226.1.1.6|H:2-97 001349233|e4w9dB1|226.1.1.6|B:2-97 001349234|e4w9dE1|226.1.1.6|E:2-97 001349235|e4w9dH1|226.1.1.6|H:2-97 001349249|e4w9eB1|226.1.1.6|B:2-97 001349250|e4w9eE1|226.1.1.6|E:2-97 001349251|e4w9eH1|226.1.1.6|H:2-97 001349266|e4w9fE1|226.1.1.6|E:2-97 001349281|e4w9gB1|226.1.1.6|B:2-97 001349282|e4w9gE1|226.1.1.6|E:2-97 001349283|e4w9gH1|226.1.1.6|H:2-97 001349297|e4w9hB1|226.1.1.6|B:2-97 001349298|e4w9hE1|226.1.1.6|E:2-97 001349307|e4w9hH1|226.1.1.6|H:2-97 001349313|e4w9iB1|226.1.1.6|B:2-97 001349314|e4w9iE1|226.1.1.6|E:2-97 001349315|e4w9iH1|226.1.1.6|H:2-97 001349329|e4w9jB1|226.1.1.6|B:2-97 001349330|e4w9jE1|226.1.1.6|E:2-97 001349331|e4w9jH1|226.1.1.6|H:2-97 001349345|e4w9kB1|226.1.1.6|B:2-97 001349346|e4w9kE1|226.1.1.6|E:2-97 001349347|e4w9kH1|226.1.1.6|H:2-97 001349361|e4w9lB1|226.1.1.6|B:2-97 001349362|e4w9lE1|226.1.1.6|E:2-97 001349363|e4w9lH1|226.1.1.6|H:2-97 001503496|e4wqoC1|226.1.1.6|C:1-96 001565035|e5bo4F1|226.1.1.6|F:2-97 001565038|e5bo4O1|226.1.1.6|O:2-97 001565039|e5bo4R1|226.1.1.6|R:2-97 002081186|e5n4wC1|226.1.1.6|C:2-97 cath|current|1lm8C00/17-112 cath|current|1lqbB00/17-112 cath|current|1vcbB00/17-112 cath|current|1vcbE00/17-112 cath|current|1vcbH00/17-112 cath|current|1vcbK00/17-112 cath|current|2fnjC00/17-112 cath|current|2jz3C00/17-112 cath|current|2xaiB00/126-220 cath|current|2xaiE00/126-220 cath|current|3zkjB00/18-112 cath|current|3zkjE00/18-112 cath|current|4n9f500/17-111 cath|current|4n9fB00/17-111 cath|current|4n9fE00/17-111 cath|current|4n9fK00/18-111 cath|current|4n9fQ00/17-111 cath|current|4n9fT00/17-111 cath|current|4n9fY00/17-111 cath|current|4n9fZ00/17-111 cath|current|4n9fh00/17-111 cath|current|4n9fn00/17-111 cath|current|4n9ft00/17-111 cath|current|4n9fz00/17-111 d1lm8c_ d1lqbb_ d1vcbb_ d1vcbe_ d1vcbh_ d1vcbk_ d2c9wc_ d2fnjc_ d2izvc_ d2jz3c_ d3dcgb_ d3dcgd_ d3zrcb_ d3zrce_ d3zrch_ d3zrck_ d3zrfb_ d3zrfe_ d3zrfh_ d3zrfk_ d3ztcb_ d3ztce_ d3ztch_ d3ztck_ d3ztdb_ d3ztde_ d3ztdh_ d3ztdk_ d3zunb_ d3zune_ d3zunh_ d3zunk_ d4awjb_ d4awje_ d4awjh_ d4awjk1 d4b9kb1 d4b9ke_ d4b9kh_ d4b9kk1 d4bksb_ d4bkse_ d4bksh_ d4bksk1 d4bktb_ d4bkte_ d4bkth_ d4bktk1 d4w9cb_ d4w9ce_ d4w9ch_ d4w9ck1 d4w9db_ d4w9de_ d4w9dh_ d4w9dk1 d4w9eb_ d4w9ee_ d4w9eh_ d4w9ek1 d4w9fb1 d4w9fe_ d4w9fk1 d4w9gb_ d4w9ge_ d4w9gh_ d4w9gk1 d4w9hb_ d4w9he_ d4w9hh_ d4w9hk1 d4w9ib_ d4w9ie_ d4w9ih_ d4w9ik1 d4w9jb_ d4w9je_ d4w9jh_ d4w9jk1 d4w9kb_ d4w9ke_ d4w9kh_ d4w9kk1 d4w9lb_ d4w9le_ d4w9lh_ d4w9lk1 d5bo4c1 d5bo4f_ d5bo4i1 d5bo4l1 d5bo4o_ d5bo4r_ d5llib1 d5llie1 d5llih1 d5llik1 d5t35c1 d5t35g1 ENSP00000430224 2fnjC NP_001191792.1.87134 NP_001191792.1.92137 NP_001191793.1.87134 NP_001191793.1.92137 XP_005563610.1.63531 XP_006139870.1.99106 XP_006767398.1.95426 XP_007999095.1.81039 XP_008148552.1.99482 XP_008954929.1.60992 XP_008981043.1.60252 XP_009242157.1.23681 XP_009242158.1.23681 XP_009467273.1.38621 XP_009569208.1.62272 XP_009687773.1.43253 XP_009909080.1.92783 XP_009993879.1.85724 XP_010009742.1.70042 XP_010115809.1.88979 XP_010192890.1.17318 XP_010201677.1.23224 XP_010349733.1.74449 XP_010364299.1.97406 XP_010364300.1.97406 XP_011365243.1.92234 XP_011742783.1.29376 XP_011837385.1.47321 XP_011914197.1.92194 XP_012351552.1.23891 XP_012351553.1.23891 XP_012667008.1.62490 XP_014112054.1.90289 XP_014349086.1.90931 XP_014349087.1.90931 XP_014349088.1.90931 XP_015001002.1.72884 XP_016814392.1.37143 XP_016814393.1.37143 XP_017377404.1.71028 XP_017707115.1.44346 XP_018098110.1.7800 XP_018424678.1.44173 XP_018888295.1.27298 XP_018888296.1.27298 XP_019308844.1.44245 XP_019469654.1.16129 XP_019499165.1.44202 XP_020385055.1.65276 XP_021544325.1.83697 XP_021589320.1.77405 13616.ENSMODP00000008638 gi|325652046|ref|NP_001191792.1| gi|325652048|ref|NP_001191793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]