SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2fq3A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2fq3A
Domain Number 1 Region: 19-102
Classification Level Classification E-value
Superfamily Homeodomain-like 5.82e-47
Family SWIRM domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2fq3A   PDB: 2fq3
Sequence length 104
Comment (A:)
Sequence
mrgshhhhhhgmassyskwfnlekihsievqslpefftnripsktpevymryrnfmvnsy
rlnpneyfsvttarrnvsgdaaalfrlhkfltkwglinyqvdsk
Download sequence
Identical sequences 2fq3_A 2fq3A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]