SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2fsvC from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2fsvC
Domain Number 1 Region: 31-202
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 9.85e-146
Family Transhydrogenase domain III (dIII) 0.0000000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2fsvC   PDB: 2fsv
Sequence length 203
Comment (C:)
Sequence
mnrsifnvilggfgseggvaaaggaagdrsvkagsaedaafimknaskviivpgygmava
qaqhalremadvlkkegvevsyaihpvagrmpghmnvllaeanvpydevfeleeinssfq
tadvafvigandvtnpaaktdpsspiygmpildvwkagtvlfikrsmasgyagvenelff
rnntmmlfgdakkmteqivqamn
Download sequence
Identical sequences 2fsv_C 2fsvC

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]