SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ftwA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ftwA
Domain Number 1 Region: 59-404
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 2.21e-112
Family Hydantoinase (dihydropyrimidinase), catalytic domain 0.00000000000434
Further Details:      
 
Domain Number 2 Region: 376-489
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 1.1e-39
Family Hydantoinase (dihydropyrimidinase) 0.00000398
Further Details:      
 
Domain Number 3 Region: 10-60
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.000000000000355
Family Hydantoinase (dihydropyrimidinase) 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ftwA   PDB: 2ftw
Sequence length 521
Comment (A:)
Sequence
mlrvdqtgtilikngtvvnddryfksdvlvengiikeiskniepkegikvvdatdklllp
ggidththfqlpfmgtvsvddfdigtqaavaggttfiidfviptrgqslleaydqwkkwa
dekvncdyslhvaitwwseqvsremeilvkergvnsfkcfmayknsfmvtdqemyhifkr
ckelgaiaqvhaengdmvfegqkkmlemgitgpeghelsrpealeaeatnraiviadsvc
tpvyivhvqsigaadvickhrkegvrvygepiaaglgvdgshmwnhdwrhaaafvmgppi
rpdprtkgvlmdylargdldcvgtdnctfcadqkamgkddftkipngvngvedrmsivwe
ngvntgkltwcqfvratsserarifniyprkgridvgcdgdiviwdpnqsktiskdthhh
avdfnifegikvtgiavttivagnivwsdnklscvkgsgrfvprppfgpvfdgieqrdkv
rnellrkvdrkpyeddntknsskpgddddkhhhhhhhhsgd
Download sequence
Identical sequences 2ftwA 2ftw_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]