SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2fug4 from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2fug4
Domain Number 1 Region: 35-409
Classification Level Classification E-value
Superfamily HydB/Nqo4-like 1.56e-135
Family Nqo4-like 0.00000000000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2fug4   PDB: 2fug
Sequence length 409
Comment (4:)
Sequence
MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIG
YLHTGFEKTMEHRTYLQNITYTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVIL
NELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLFEWVTGQRFHHNYIRIGGVKE
DLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLR
ASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPG
PVRDPNPQITPPPRHLLETSMEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSD
GGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASLDPVMGDVDR
Download sequence
Identical sequences Q56220
300852.TTHA0087 2fug_4 2fug_D 2fug_M 2fug_V 2ybb_4 3i9v_4 3i9v_D 3iam_4 3iam_D 3ias_4 3ias_D 3ias_M 3ias_V 3m9s_4 3m9s_D 4hea_4 4hea_E gi|55980056|ref|YP_143353.1| ttk003000439.1 WP_011227699.1.52262 YP_143353.1.19876 2fug4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]