SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2fw1A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2fw1A
Domain Number 1 Region: 25-174
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 9.52e-93
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.0000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2fw1A   PDB: 2fw1
Sequence length 183
Comment (A:)
Sequence
mmsetaplpsassaledkaasapvvgiimgsqsdwetmrhadallteleiphetlivsah
rtpdrladyartaaerglnviiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsll
sivqmpggvpvgtlaigasgaknaallaasilalynpalaarletwralqtasvpnspit
edk
Download sequence
Identical sequences 2fw1A 2fw1_A 2fw1_B 2fwj_A 2fwj_B 5clf_A 5clf_B 5cli_A 5cli_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]