SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2g0wA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2g0wA
Domain Number 1 Region: 22-294
Classification Level Classification E-value
Superfamily Xylose isomerase-like 8.06e-74
Family IolI-like 0.000000000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2g0wA   PDB: 2g0w
Sequence length 296
Comment (A:)
Sequence
mgsdkihhhhhhmtnangnlkkcpitissytlgtevsfpkrvkvaaengfdgiglraeny
vdalaagltdedmlrildehnmkvteveyitqwgtaedrtaeqqkkeqttfhmarlfgvk
hincgllekipeeqiivalgelcdraeeliiglefmpysgvadlqaawrvaeacgrdnaq
licdtwhwaranqtaesiknvpadrivsiqlcdvhetpykelreeslhdrlapgegygdt
vgfakilkehgvnprvmgvevisdsmvatgleyaalkvynatkkvldeawpeispr
Download sequence
Identical sequences 2g0w_A 2g0w_B 2g0wA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]