SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2g3bA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2g3bA
Domain Number 1 Region: 74-185
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 4.55e-25
Family Tetracyclin repressor-like, C-terminal domain 0.00000123
Further Details:      
 
Domain Number 2 Region: 3-56
Classification Level Classification E-value
Superfamily Homeodomain-like 6.17e-17
Family Tetracyclin repressor-like, N-terminal domain 0.00031
Further Details:      
 
Domain Number 3 Region: 3-84
Classification Level Classification E-value
Superfamily PDB 0.000000000381
Family PDB 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2g3bA   PDB: 2g3b
Sequence length 208
Comment (A:)
Sequence
MSERRDAILKASATAIAQRGIRGLRVNDVAEVAGVSPGLLYYHFKDRIGLLEAALNYIND
RARAYRSEGEGSGDSARDRLTRSLLGEIQDRPEVVENSLAWNELRASAVYEEALRDPLAR
TTAAWVSEIADAIVQAQATGEISRSLDPQPTAVTMTALVEGLSGRWLCKEISTEDARSHL
LGAIDVVMSEPTHHTADTPVTPTPKEYR
Download sequence
Identical sequences Q0S8G3
2g3b_A 2g3b_B gi|111021359|ref|YP_704331.1| APC6001 WP_011596808.1.78234 101510.RHA1_ro04387 2g3bA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]