SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2g7sA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2g7sA
Domain Number 1 Region: 80-192
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 2.22e-30
Family Tetracyclin repressor-like, C-terminal domain 0.000000697
Further Details:      
 
Domain Number 2 Region: 7-73
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000633
Family Tetracyclin repressor-like, N-terminal domain 0.0000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2g7sA   PDB: 2g7s
Sequence length 194
Comment (A:)
Sequence
gsmknpqskaddilqcartliirggynsfsyadisqvvgirnasihhhfpsksdlvcklv
sqyrqeaeagiaeleknisdpleqlrayigywegciadathpfcvcallaseipvlpetv
vlevrahfrslsdwltavlergiaqgrlvltgtaranaeifmatvhgamlsarahgdaat
fgaitrpmlerita
Download sequence
Identical sequences 2g7sA 2g7s_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]