SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ggpB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ggpB
Domain Number 1 Region: 6-68
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 9.53e-25
Family HMA, heavy metal-associated domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ggpB   PDB: 2ggp
Sequence length 72
Comment (B:)
Sequence
arevilavhgmtcsactntintqlralkgvtkcdislvtnecqvtydnevtadsikeiie
dcgfdceilrds
Download sequence
Identical sequences 1fvq_A 1fvs_A 2ggp_B 2ggpB 000005140|e2ggpB1|304.3.1.7|B:1-72 000064403|e1fvsA1|304.3.1.7|A:1-72 000064404|e1fvqA1|304.3.1.7|A:1-72 cath|current|1fvqA00/1-72 cath|current|1fvsA00/1-72 cath|current|2ggpB00/1-72

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]