SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2gjvA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2gjvA
Domain Number 1 Region: 25-157
Classification Level Classification E-value
Superfamily Phage tail protein-like 4.54e-47
Family STM4215-like 0.000000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2gjvA   PDB: 2gjv
Sequence length 175
Comment (A:)
Sequence
mhhhhhhssgvdlgtenlyfqsnametlsvihtvanrlrelnpdmdihisstdakvyipt
gqqvtvlihycgsvfaepentdatvqkqlirisatvivpqisdainaldrlrrslggiel
pdcdrplwlesekyigdaanfcryaldmtastlfiaeqeskdsplltivnyeeiq
Download sequence
Identical sequences 2gjv_A 2gjv_B 2gjv_C 2gjv_D 2gjv_E 2gjv_F 2gjvA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]