SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2gm3A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2gm3A
Domain Number 1 Region: 6-169
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.96e-35
Family Universal stress protein-like 0.0000000548
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2gm3A   PDB: 2gm3
Sequence length 175
Comment (A:)
Sequence
sgseptkvmvavnastikdypnpsisckrafewtlekivrsntsdfkilllhvqvvdedg
fddvdsiyaspedfrdmrqsnkakglhlleffvnkcheigvgceawiktgdpkdvicqev
krvrpdflvvgsrglgrfqkvfvgtvsafcvkhaecpvmtikrnadetpsdpadd
Download sequence
Identical sequences 2gm3_A 2gm3_B 2gm3_C 2gm3_D 2gm3_E 2gm3_F 2gm3A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]