SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2gokA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2gokA
Domain Number 1 Region: 80-380
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 5.01e-87
Family Imidazolonepropionase-like 0.0000000000719
Further Details:      
 
Domain Number 2 Region: 18-80,381-419
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 4.22e-34
Family Imidazolonepropionase-like 0.0000907
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2gokA   PDB: 2gok
Sequence length 429
Comment (A:)
Sequence
mslpgnnsakgtatgnatalwrnaqlatlnpamdgigavenaviavrngriafagpesdl
pddlstadettdcggrwitpalidchthlvfggnramefemrlngatyeeiakagggivs
svrdtralsdevlvaqalprldtllsegvstieiksgygldietelkmlrvarrletlrp
vrivtsylaahatpadykgrnadyitdvvlpglekahaegladavdgfcegiafsvkeid
rvfaaaqqrglpvklhaeqlsnlggaelaasynalsadhleyldetgakalakagtvavl
lpgafyalrekqlppvqalrdagaeialatdcnpgtspltsllltmnmgatlfrmtveec
ltattrnaakalgllaetgtleagksadfaiwdierpaelvyrigfnplharifkgqkvs
peghhhhhh
Download sequence
Identical sequences 2gokA 2gok_A 2gok_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]