SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2grrB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2grrB
Domain Number 1 Region: 14-169
Classification Level Classification E-value
Superfamily Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain 3.15e-61
Family Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain 0.0000000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2grrB   PDB: 2grr
Sequence length 170
Comment (B:)
Sequence
stgepapvlsspppadvstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvs
svfkdeatvrmavqdavdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlyg
plmalnhmvqqdyfpkalaplllafvtkpnsalescsfarhsllqtlykv
Download sequence
Identical sequences 2grn_B 2gro_B 2grp_B 2grq_B 2grr_B cath|current|2grnB00/431-587 cath|current|2groB00/431-587 cath|current|2grpB00/431-587 cath|current|2grqB00/431-587 cath|current|2grrB00/431-587 2grrB

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]