SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2hddA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2hddA
Domain Number 1 Region: 4-57
Classification Level Classification E-value
Superfamily Homeodomain-like 1.36e-26
Family Homeodomain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2hddA   PDB: 2hdd   SUPERFAMILY: 2hddA
Sequence length 61
Comment (A:)
Sequence
maekrprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfknkrakikk
s
Download sequence
Identical sequences 2hdd_A 2hdd_B 2hddA cath|current|2hddA00/5-59 cath|current|2hddB00/2-57

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]