SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2hfdA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2hfdA
Domain Number 1 Region: 5-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.82e-25
Family HyaE-like 0.000000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2hfdA   PDB: 2hfd
Sequence length 140
Comment (A:)
Sequence
msndtpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmige
llrefpdytwqvaiadleqseaigdrfgvfrfpatlvftggnyrgvlngihpwaelinlm
rglvepqqeraslehhhhhh
Download sequence
Identical sequences 2hfdA 2hfd_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]