SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2hi3A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2hi3A
Domain Number 1 Region: 9-66
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000339
Family Homeodomain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2hi3A   PDB: 2hi3
Sequence length 73
Comment (A:)
Sequence
msaqtvsgptedqveileynfnkvnkhpdpttlcliaaeaglteeqtqkwfkqrlaewrr
seglpsecrsvtd
Download sequence
Identical sequences d2hi3a_ 2hi3A 2hi3_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]