SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2hkuA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2hkuA
Domain Number 1 Region: 90-209
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 2.46e-47
Family Tetracyclin repressor-like, C-terminal domain 0.000000449
Further Details:      
 
Domain Number 2 Region: 20-76
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000353
Family Tetracyclin repressor-like, N-terminal domain 0.00014
Further Details:      
 
Domain Number 3 Region: 11-116
Classification Level Classification E-value
Superfamily PDB 0.0000102
Family PDB 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2hkuA   PDB: 2hku
Sequence length 215
Comment (A:)
Sequence
ghmvpqtgraaratresgrqtrdalftaatelflehgegvpitqicaaagahpnqvtyyy
gskerlfvevacaavlragkraeddaataetvgdyteklvgsllgpgapsvelftsamlm
tgrrselrdlitdtlrtlhssgevalirtlmrtgwqlragidveskafwsaifglviqkt
atgesfgysleeavavifanlqipetvrntsidgs
Download sequence
Identical sequences 2hku_A 2hku_B 2hkuA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]