SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2hpaA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2hpaA
Domain Number 1 Region: 2-328
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 1.17e-127
Family Histidine acid phosphatase 0.00000000003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2hpaA   PDB: 2hpa   SUPERFAMILY: 2hpaA
Sequence length 342
Comment (A:)
Sequence
kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt
Download sequence
Identical sequences 1cvi_A 1cvi_B 1cvi_C 1cvi_D 2hpa_A 2hpa_B 2hpa_C 2hpa_D 2hpaA 000010474|e1nd6A1|2111.21.1.2|A:1-342 000108914|e2hpaA1|2111.21.1.2|A:1-342 000108915|e1cviA1|2111.21.1.2|A:1-342 000108916|e1nd5C1|2111.21.1.2|C:1-342 000108917|e2hpaD1|2111.21.1.2|D:1-342 000108918|e1nd5A1|2111.21.1.2|A:1-342 000108919|e2hpaB1|2111.21.1.2|B:1-342 000108920|e1cviD1|2111.21.1.2|D:1-342 000108921|e1cviB1|2111.21.1.2|B:1-342 000108922|e1nd6D1|2111.21.1.2|D:1-342 000108924|e1nd6C1|2111.21.1.2|C:1-342 000108925|e1cviC1|2111.21.1.2|C:1-342 000108926|e1nd5B1|2111.21.1.2|B:1-342 000108927|e1nd6B1|2111.21.1.2|B:1-342 000108928|e1nd5D1|2111.21.1.2|D:1-342 000108929|e2hpaC1|2111.21.1.2|C:1-342 cath|current|1cviA00/1001-1342 cath|current|1cviB00/2001-2342 cath|current|1cviC00/3001-3342 cath|current|1cviD00/4001-4342 cath|current|2hpaA00/1001-1342 cath|current|2hpaB00/2001-2342 cath|current|2hpaC00/3001-3342 cath|current|2hpaD00/4001-4342 d1cvia_ d1cvib_ d1cvic_ d1cvid_ d1nd5a_ d1nd5c_ d1nd5d_ d1nd6a_ d1nd6c_ d1nd6d_ d2hpaa_ d2hpab_ d2hpac_ d2hpad_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]