SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2hyjA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2hyjA
Domain Number 1 Region: 83-198
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 2.43e-28
Family Tetracyclin repressor-like, C-terminal domain 0.000000636
Further Details:      
 
Domain Number 2 Region: 10-76
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000206
Family Tetracyclin repressor-like, N-terminal domain 0.0000529
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2hyjA   PDB: 2hyj
Sequence length 200
Comment (A:)
Sequence
MSPRRSAAEAQATRGRILGRAAEIASEEGLDGITIGRLAEELEMSKSGVHKHFGTKETLQ
ISTLDKAFVDFWHRVVEPALAEPPGLRRLRAVCANSVGYLEEPLLPGGCLLTAALSEYDG
RPGRVRDAVAEVWSRWREQLRADLTAAVDKGELPAGFDVEQALFEIVAAGLALNAAMQLQ
HDRTAADRARRAIERALAQS
Download sequence
Identical sequences D6EXU0 Q8CJS4
2hyjA 2hyj_A 100226.SCO4940 APC6243 gi|32141251|ref|NP_733652.1| NP_733652.1.49638 WP_003974034.1.26049 WP_003974034.1.43399 WP_003974034.1.55229 WP_003974034.1.86682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]