SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2i2tX from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2i2tX
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily L28p-like 5.93e-30
Family Ribosomal protein L28 0.00000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2i2tX   PDB: 2i2t
Sequence length 77
Comment (X:)
Sequence
srvcqvtgkrpvtgnnrshalnatkrrflpnlhshrfwvesekrfvtlrvsakgmrvidk
kgidtvlaelrargeky
Download sequence
Identical sequences 000008226|e2qamZ1|4232.1.1.6|Z:2-78 000089824|e2qozZ1|4232.1.1.6|Z:2-78 000089825|e2qoxZ1|4232.1.1.6|Z:2-78 000089826|e2qovZ1|4232.1.1.6|Z:2-78 000089827|e2i2vX1|4232.1.1.6|X:1-77 000089828|e2qbcZ1|4232.1.1.6|Z:2-78 000089829|e2qbaZ1|4232.1.1.6|Z:2-78 000089830|e2i2tX1|4232.1.1.6|X:1-77 000089831|e3df4Z1|4232.1.1.6|Z:2-78 000089832|e2z4nZ1|4232.1.1.6|Z:2-78 000089833|e2qbgZ1|4232.1.1.6|Z:2-78 000089834|e2qbeZ1|4232.1.1.6|Z:2-78 000089835|e3df2Z1|4232.1.1.6|Z:2-78 000089836|e2qbiZ1|4232.1.1.6|Z:2-78 000089837|e2qaoZ1|4232.1.1.6|Z:2-78 000089838|e2qp1Z1|4232.1.1.6|Z:2-78 000089839|e2z4lZ1|4232.1.1.6|Z:2-78 000089840|e2qbkZ1|4232.1.1.6|Z:2-78 000140886|e1vt2X1|4232.1.1.6|X:2-78 000148733|e3j0tZ1|4232.1.1.6|Z:1-77 000149817|e3j19X1|4232.1.1.6|X:1-77 000235923|e3j3711|4232.1.1.6|1:1-77 000357998|e3fikX1|4232.1.1.6|X:1-77 000371396|e3i1nX1|4232.1.1.6|X:2-78 000371449|e3i1pX1|4232.1.1.6|X:2-78 000371502|e3i1rX1|4232.1.1.6|X:2-78 000371555|e3i1tX1|4232.1.1.6|X:2-78 000371608|e3i20X1|4232.1.1.6|X:2-78 000371661|e3i22X1|4232.1.1.6|X:2-78 000385514|e3kcrX1|4232.1.1.6|X:2-78 000388702|e2wwq01|4232.1.1.6|0:1-77 000402226|e3orbX1|4232.1.1.6|X:2-78 000402651|e3ofqX1|4232.1.1.6|X:1-77 000402684|e3ofrX1|4232.1.1.6|X:1-77 000403158|e3ofcX1|4232.1.1.6|X:1-77 000403189|e3ofdX1|4232.1.1.6|X:1-77 000403264|e3ofzX1|4232.1.1.6|X:1-77 000403295|e3og0X1|4232.1.1.6|X:1-77 000408176|e3oasX1|4232.1.1.6|X:1-77 000408209|e3oatX1|4232.1.1.6|X:1-77 000415462|e3iztY1|4232.1.1.6|Y:2-78 000415497|e3izuY1|4232.1.1.6|Y:2-78 000417381|e3j01X1|4232.1.1.6|X:1-77 000420942|e3r8sX1|4232.1.1.6|X:1-77 000420973|e3r8tX1|4232.1.1.6|X:1-77 001067042|e4kixX1|4232.1.1.6|X:2-78 001067102|e4kizX1|4232.1.1.6|X:2-78 001067160|e4kj1X1|4232.1.1.6|X:2-78 001067218|e4kj3X1|4232.1.1.6|X:2-78 001067275|e4kj5X1|4232.1.1.6|X:2-78 001067333|e4kj7X1|4232.1.1.6|X:2-78 001067390|e4kj9X1|4232.1.1.6|X:2-78 001067448|e4kjbX1|4232.1.1.6|X:2-78 001109816|e3j4xX1|4232.1.1.6|X:3-79 001109900|e3j50X1|4232.1.1.6|X:3-79 001109935|e3j51X1|4232.1.1.6|X:3-79 001109970|e3j52X1|4232.1.1.6|X:3-79 001110028|e3j54X1|4232.1.1.6|X:3-79 001110086|e3j56X1|4232.1.1.6|X:3-79 001110144|e3j58X1|4232.1.1.6|X:3-79 001110202|e3j5aX1|4232.1.1.6|X:3-79 001110260|e3j5cX1|4232.1.1.6|X:3-79 001110318|e3j5eX1|4232.1.1.6|X:3-79 001110376|e3j5gX1|4232.1.1.6|X:3-79 001110434|e3j5iX1|4232.1.1.6|X:3-79 001110492|e3j5kX1|4232.1.1.6|X:3-79 001124412|e3j5oX1|4232.1.1.6|X:2-78 001124996|e3j5uZ1|4232.1.1.6|Z:1-77 001125031|e3j5w11|4232.1.1.6|1:1-77 001147862|e3j5lX1|4232.1.1.6|X:1-77 001227328|e3uos12|4232.1.1.6|1:2-78 001227331|e3sgf12|4232.1.1.6|1:2-78 001227350|e4gauX2|4232.1.1.6|X:2-78 001227356|e4garX2|4232.1.1.6|X:2-78 001227368|e3j11Z2|4232.1.1.6|Z:1-77 001227369|e3j12Z2|4232.1.1.6|Z:1-77 001227377|e3j14Z2|4232.1.1.6|Z:1-77 001294211|e4csu01|4232.1.1.6|0:1-77 001317017|e4pebX1|4232.1.1.6|X:1-77 001317052|e4pecX1|4232.1.1.6|X:1-77 001317270|e4tomX1|4232.1.1.6|X:1-77 001317328|e4tooX1|4232.1.1.6|X:1-77 001317384|e4tovX1|4232.1.1.6|X:1-77 001317442|e4toxX1|4232.1.1.6|X:1-77 001317498|e4tp1X1|4232.1.1.6|X:1-77 001317556|e4tp3X1|4232.1.1.6|X:1-77 001317612|e4tp5X1|4232.1.1.6|X:1-77 001317670|e4tp7X1|4232.1.1.6|X:1-77 001317726|e4tp9X1|4232.1.1.6|X:1-77 001317784|e4tpbX1|4232.1.1.6|X:1-77 001317840|e4tpdX1|4232.1.1.6|X:1-77 001317898|e4tpfX1|4232.1.1.6|X:1-77 001401562|e3j7zX1|4232.1.1.6|X:2-78 001405781|e4uy8X1|4232.1.1.6|X:1-77 001406402|e4wapX1|4232.1.1.6|X:1-77 001406460|e4warX1|4232.1.1.6|X:1-77 001411851|e3j8g01|4232.1.1.6|0:2-78 001423795|e4u1uBX1|4232.1.1.6|BX:1-77 001423796|e4u1uDX1|4232.1.1.6|DX:1-77 001423909|e4u1vBX1|4232.1.1.6|BX:1-77 001423910|e4u1vDX1|4232.1.1.6|DX:1-77 001424023|e4u20BX1|4232.1.1.6|BX:1-77 001424024|e4u20DX1|4232.1.1.6|DX:1-77 001424137|e4u24BX1|4232.1.1.6|BX:1-77 001424138|e4u24DX1|4232.1.1.6|DX:1-77 001424251|e4u25BX1|4232.1.1.6|BX:1-77 001424252|e4u25DX1|4232.1.1.6|DX:1-77 001424365|e4u26BX1|4232.1.1.6|BX:1-77 001424366|e4u26DX1|4232.1.1.6|DX:1-77 001424479|e4u27BX1|4232.1.1.6|BX:1-77 001424480|e4u27DX1|4232.1.1.6|DX:1-77 001430458|e4v50BX1|4232.1.1.6|BX:1-77 001430459|e4v50DX1|4232.1.1.6|DX:1-77 001430694|e4v52BZ1|4232.1.1.6|BZ:2-78 001430695|e4v52DZ1|4232.1.1.6|DZ:2-78 001430806|e4v53BZ1|4232.1.1.6|BZ:2-78 001430807|e4v53DZ1|4232.1.1.6|DZ:2-78 001430918|e4v54BZ1|4232.1.1.6|BZ:2-78 001430919|e4v54DZ1|4232.1.1.6|DZ:2-78 001431032|e4v55BZ1|4232.1.1.6|BZ:2-78 001431033|e4v55DZ1|4232.1.1.6|DZ:2-78 001431146|e4v56BZ1|4232.1.1.6|BZ:2-78 001431147|e4v56DZ1|4232.1.1.6|DZ:2-78 001431258|e4v57BZ1|4232.1.1.6|BZ:2-78 001431259|e4v57DZ1|4232.1.1.6|DZ:2-78 001432270|e4v5hB01|4232.1.1.6|B0:1-77 001434060|e4v5yBZ1|4232.1.1.6|BZ:2-78 001434061|e4v5yDZ1|4232.1.1.6|DZ:2-78 001434855|e4v64BZ1|4232.1.1.6|BZ:2-78 001434856|e4v64DZ1|4232.1.1.6|DZ:2-78 001435213|e4v69BX1|4232.1.1.6|BX:1-77 001435590|e4v6cBX1|4232.1.1.6|BX:2-78 001435591|e4v6cDX1|4232.1.1.6|DX:2-78 001435702|e4v6dBX1|4232.1.1.6|BX:2-78 001435703|e4v6dDX1|4232.1.1.6|DX:2-78 001435814|e4v6eBX1|4232.1.1.6|BX:2-78 001435815|e4v6eDX1|4232.1.1.6|DX:2-78 001436195|e4v6kAY1|4232.1.1.6|AY:2-78 001436277|e4v6lBY1|4232.1.1.6|BY:2-78 001436338|e4v6mBX1|4232.1.1.6|BX:1-77 001436374|e4v6nAZ1|4232.1.1.6|AZ:1-77 001436451|e4v6oBZ1|4232.1.1.6|BZ:1-77 001436509|e4v6pBZ1|4232.1.1.6|BZ:1-77 001436567|e4v6qBZ1|4232.1.1.6|BZ:1-77 001436624|e4v6rBZ1|4232.1.1.6|BZ:1-77 001436661|e4v6sAZ1|4232.1.1.6|AZ:1-77 001436744|e4v6tBX1|4232.1.1.6|BX:1-77 001436875|e4v6vB11|4232.1.1.6|B1:1-77 001437135|e4v6yBX1|4232.1.1.6|BX:3-79 001437193|e4v6zBX1|4232.1.1.6|BX:3-79 001437251|e4v70BX1|4232.1.1.6|BX:3-79 001437309|e4v71BX1|4232.1.1.6|BX:3-79 001437367|e4v72BX1|4232.1.1.6|BX:3-79 001437425|e4v73BX1|4232.1.1.6|BX:3-79 001437483|e4v74BX1|4232.1.1.6|BX:3-79 001437541|e4v75BX1|4232.1.1.6|BX:3-79 001437599|e4v76BX1|4232.1.1.6|BX:3-79 001437657|e4v77BX1|4232.1.1.6|BX:3-79 001437715|e4v78BX1|4232.1.1.6|BX:3-79 001437773|e4v79BX1|4232.1.1.6|BX:3-79 001437831|e4v7aBX1|4232.1.1.6|BX:3-79 001437893|e4v7bBX1|4232.1.1.6|BX:2-78 001437953|e4v7cBZ1|4232.1.1.6|BZ:1-77 001437989|e4v7dA11|4232.1.1.6|A1:1-77 001438351|e4v7iAX1|4232.1.1.6|AX:2-78 001439373|e4v7sBX1|4232.1.1.6|BX:1-77 001439374|e4v7sDX1|4232.1.1.6|DX:1-77 001439485|e4v7tBX1|4232.1.1.6|BX:1-77 001439486|e4v7tDX1|4232.1.1.6|DX:1-77 001439601|e4v7uBX1|4232.1.1.6|BX:1-77 001439602|e4v7uDX1|4232.1.1.6|DX:1-77 001439709|e4v7vBX1|4232.1.1.6|BX:1-77 001439710|e4v7vDX1|4232.1.1.6|DX:1-77 001440257|e4v80BX1|4232.1.1.6|BX:2-78 001440258|e4v80DX1|4232.1.1.6|DX:2-78 001440652|e4v85B11|4232.1.1.6|B1:2-78 001441055|e4v89B11|4232.1.1.6|B1:2-78 001445202|e4v9cBX1|4232.1.1.6|BX:2-78 001445203|e4v9cDX1|4232.1.1.6|DX:2-78 001445315|e4v9dCX1|4232.1.1.6|CX:1-77 001445316|e4v9dDX1|4232.1.1.6|DX:1-77 001446353|e4v9oAX1|4232.1.1.6|AX:2-78 001446354|e4v9oCX1|4232.1.1.6|CX:2-78 001446355|e4v9oEX1|4232.1.1.6|EX:2-78 001446356|e4v9oGX1|4232.1.1.6|GX:2-78 001446597|e4v9pAX1|4232.1.1.6|AX:2-78 001446598|e4v9pCX1|4232.1.1.6|CX:2-78 001446599|e4v9pEX1|4232.1.1.6|EX:2-78 001446600|e4v9pGX1|4232.1.1.6|GX:2-78 001447809|e4wf1BX1|4232.1.1.6|BX:1-77 001447810|e4wf1DX1|4232.1.1.6|DX:1-77 001482266|e4wwwRX1|4232.1.1.6|RX:1-77 001482267|e4wwwYX1|4232.1.1.6|YX:1-77 001504101|e5afiX1|4232.1.1.6|X:2-78 001513286|e4ybbCY1|4232.1.1.6|CY:1-77 001514501|e4ybbDY1|4232.1.1.6|DY:1-77 001546939|e3j9yX1|4232.1.1.6|X:2-78 001564392|e3j9zLV1|4232.1.1.6|LV:1-77 001564449|e3ja1LZ1|4232.1.1.6|LZ:1-77 001675108|e4woiBX1|4232.1.1.6|BX:2-78 001675109|e4woiCX1|4232.1.1.6|CX:2-78 001693808|e5adyX1|4232.1.1.6|X:2-78 001724362|e3jcdX1|4232.1.1.6|X:2-78 001724420|e3jceX1|4232.1.1.6|X:2-78 001732116|e5gadY1|4232.1.1.6|Y:2-78 001732153|e5gaeY1|4232.1.1.6|Y:2-78 001732189|e5gagY1|4232.1.1.6|Y:2-78 001732223|e5gahY1|4232.1.1.6|Y:2-78 001732359|e3jbu01|4232.1.1.6|0:2-78 001732413|e3jbv01|4232.1.1.6|0:2-78 001735121|e5gafY1|4232.1.1.6|Y:1-77 001781028|e3jcjW1|4232.1.1.6|W:2-78 001781088|e3jcnX1|4232.1.1.6|X:2-78 001828020|e5iqrX1|4232.1.1.6|X:2-78 001859953|e5j88CY1|4232.1.1.6|CY:1-77 001859954|e5j88DY1|4232.1.1.6|DY:1-77 001860066|e5j8aCY1|4232.1.1.6|CY:1-77 001860067|e5j8aDY1|4232.1.1.6|DY:1-77 001860179|e5j91CY1|4232.1.1.6|CY:1-77 001860180|e5j91DY1|4232.1.1.6|DY:1-77 001860292|e5jc9CY1|4232.1.1.6|CY:1-77 001860293|e5jc9DY1|4232.1.1.6|DY:1-77 001867527|e5jteBX1|4232.1.1.6|BX:2-78 001867582|e5ju8BX1|4232.1.1.6|BX:2-78 001867613|e5l3p11|4232.1.1.6|1:2-78 001868986|e5it8CY1|4232.1.1.6|CY:1-77 001868987|e5it8DY1|4232.1.1.6|DY:1-77 001869099|e5j5bCY1|4232.1.1.6|CY:1-77 001869100|e5j5bDY1|4232.1.1.6|DY:1-77 001869212|e5j7lCY1|4232.1.1.6|CY:1-77 001869213|e5j7lDY1|4232.1.1.6|DY:1-77 001872172|e5kcr111|4232.1.1.6|11:2-78 001872230|e5kcs111|4232.1.1.6|11:2-78 001888219|e5kpsX1|4232.1.1.6|X:2-78 001888277|e5kpvW1|4232.1.1.6|W:2-78 001888335|e5kpwW1|4232.1.1.6|W:2-78 001888393|e5kpxW1|4232.1.1.6|W:2-78 001921132|e5lzaX1|4232.1.1.6|X:1-77 001921193|e5lzbX1|4232.1.1.6|X:1-77 001921254|e5lzcX1|4232.1.1.6|X:1-77 001921315|e5lzdX1|4232.1.1.6|X:1-77 001921369|e5lzeX1|4232.1.1.6|X:1-77 001921423|e5lzfX1|4232.1.1.6|X:1-77 001934408|e5mdvX1|4232.1.1.6|X:2-78 001934470|e5mdwX1|4232.1.1.6|X:2-78 001934528|e5mdzX1|4232.1.1.6|X:2-78 001934583|e5mgpX1|4232.1.1.6|X:1-77 001935698|e5mdyX1|4232.1.1.6|X:2-78 001945676|e5u4iY1|4232.1.1.6|Y:2-78 001949552|e5h5uY1|4232.1.1.6|Y:1-77 002047170|e5u9f261|4232.1.1.6|26:2-78 002047234|e5u9g261|4232.1.1.6|26:2-78 002077841|e5ncoY1|4232.1.1.6|Y:1-77 002081692|e5uyk261|4232.1.1.6|26:1-77 002081755|e5uym261|4232.1.1.6|26:1-77 002081817|e5uyn261|4232.1.1.6|26:1-77 002081879|e5uyp261|4232.1.1.6|26:1-77 002081941|e5uyq261|4232.1.1.6|26:1-77 002083711|e5np6v1|4232.1.1.6|v:1-77 002083747|e5uyl261|4232.1.1.6|26:1-77 002094212|e5nwyk1|4232.1.1.6|k:2-78 002096204|e5o2rX1|4232.1.1.6|X:1-77 cath|current|2i2tX00/1-77 cath|current|2i2vX00/1-77 cath|current|3oasX00/1-77 cath|current|3oatX00/1-77 cath|current|3ofcX00/1-77 cath|current|3ofdX00/1-77 cath|current|3ofqX00/1-77 cath|current|3ofrX00/1-77 cath|current|3ofzX00/1-77 cath|current|3og0X00/1-77 cath|current|3r8sX00/1-77 cath|current|3r8tX00/1-77 cath|current|4pebX00/2-78 cath|current|4pecX00/2-78 cath|current|4tomX00/2-78 cath|current|4tooX00/2-78 cath|current|4tovX00/2-78 cath|current|4toxX00/2-78 cath|current|4tp1X00/2-78 cath|current|4tp3X00/2-78 cath|current|4tp5X00/2-78 cath|current|4tp7X00/2-78 cath|current|4tp9X00/2-78 cath|current|4tpbX00/2-78 cath|current|4tpdX00/2-78 cath|current|4tpfX00/2-78 cath|current|4uy8X00/1-77 cath|current|4wapX00/2-78 cath|current|4warX00/2-78 d2i2tx1 d2i2vx1 d2qamz1 d2qaoz1 d2qbaz1 d2qbcz1 d2qbez1 d2qbgz1 d2qbiz1 d2qbkz1 d2qovz1 d2qoxz1 d2qozz1 d2qp1z1 d2z4lz1 d2z4nz1 d3df2z1 d3df4z1 ER84S 3j5l_X 3j9z_LV 3ja1_LZ 4csu_0 4u1u_BX 4u1u_DX 4u1v_BX 4u1v_DX 4u20_BX 4u20_DX 4u24_BX 4u24_DX 4u25_BX 4u25_DX 4u26_BX 4u26_DX 4u27_BX 4u27_DX 4uy8_X 4v50_BX 4v50_DX 4v5h_B0 4v69_BX 4v6m_BX 4v6n_AZ 4v6o_BZ 4v6p_BZ 4v6q_BZ 4v6r_BZ 4v6s_AZ 4v6t_BX 4v6v_B1 4v7c_BZ 4v7d_A1 4v7s_BX 4v7s_DX 4v7t_BX 4v7t_DX 4v7u_BX 4v7u_DX 4v7v_BX 4v7v_DX 4v9d_CX 4v9d_DX 4wf1_BX 4wf1_DX 4www_RX 4www_YX 4ybb_CY 4ybb_DY 5gaf_Y 5h5u_Y 5it8_CY 5it8_DY 5j5b_CY 5j5b_DY 5j7l_CY 5j7l_DY 5j88_CY 5j88_DY 5j8a_CY 5j8a_DY 5j91_CY 5j91_DY 5jc9_CY 5jc9_DY 5lza_X 5lzb_X 5lzc_X 5lzd_X 5lze_X 5lzf_X 5mgp_X 5nco_Y 5np6_v 5o2r_X 5uyk_26 5uyl_26 5uym_26 5uyn_26 5uyp_26 5uyq_26 5wdt_X 5we4_X 5we6_X 5wf0_X 5wfk_X 5wfs_X 6bu8_26 6enf_X 6enj_X 6enu_X 6gbz_X 6gc0_X 6gc4_X 6gc8_X 6gwt_X 6gxm_X 6gxn_X 6gxo_X 6gxp_X 6h4n_X 6h58_X 6h58_XX 2i2tX

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]