SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2i5dA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2i5dA
Domain Number 1 Region: 12-192
Classification Level Classification E-value
Superfamily ITPase-like 4.85e-91
Family ITPase (Ham1) 0.0000000794
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2i5dA   PDB: 2i5d
Sequence length 197
Comment (A:)
Sequence
gshmaaslvgkkivfvtgnakkleevvqilgdkfpctlvaqkidlpeyqgepdeisiqkc
qeavrqvqgpvlvedtclcfnalgglpgpyikwfleklkpeglhqllagfedksayalct
falstgdpsqpvrlfrgrtsgrivaprgcqdfgwdpcfqpdgyeqtyaempkaeknavsh
rfrallelqeyfgslaa
Download sequence
Identical sequences 2i5dA 2i5d_A cath|current|2i5dA00/0-194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]