SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2id3A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2id3A
Domain Number 1 Region: 104-221
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 1.75e-27
Family Tetracyclin repressor-like, C-terminal domain 0.000000545
Further Details:      
 
Domain Number 2 Region: 36-98
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000949
Family Tetracyclin repressor-like, N-terminal domain 0.0000744
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2id3A   PDB: 2id3
Sequence length 225
Comment (A:)
Sequence
mgsshhhhhhssgrenlyfqghmpdpaapgtlrpggrtarireavllaagdalaadgfda
ldlgeiarragvgkttvyrrwgtpgglaadlladmaeqslpradtgaleedlranarlvv
rtlddprqgrlfraliaaslcneqaaealhrfyavrvdewagcvrdavargevpdgtdph
gvvaavsaplyyallntgrslteadadraaraastaaragvwvtg
Download sequence
Identical sequences 2id3A 2id3_A 2id3_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]