SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2id6A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2id6A
Domain Number 1 Region: 78-202
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 3.69e-30
Family Tetracyclin repressor-like, C-terminal domain 0.000000346
Further Details:      
 
Domain Number 2 Region: 6-59
Classification Level Classification E-value
Superfamily Homeodomain-like 6.49e-23
Family Tetracyclin repressor-like, N-terminal domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2id6A   PDB: 2id6
Sequence length 202
Comment (A:)
Sequence
ghmlskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsv
teklqkefenflmknrnrdifdfmerwiekkleysashpeeadflitlvsvdeglrkril
ldleksqrvffdfvreklkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkr
dmntlveevkvmlrilkkgmtk
Download sequence
Identical sequences 2id6_A 3ih2_A 3ih3_A 3ih4_A 4i6z_A 4i6z_B 4i76_A 4i76_B 2id6A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]