SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ielA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ielA
Domain Number 1 Region: 3-135
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.31e-35
Family Universal stress protein-like 0.000000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ielA   PDB: 2iel
Sequence length 138
Comment (A:)
Sequence
marylvvahrtakspelaaklkellaqdpearfvllvpavpppgwvyeenevrrraeeea
aaakraleaqgipveeakagdispllaieeellahpgayqgivlstlppglsrwlrldvh
tqaerfglpvihviaqaa
Download sequence
Identical sequences WP_024119060.1.52262 2iel_A 2iel_B 2ielA cath|current|2ielA00/2-135 cath|current|2ielB00/3-136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]