SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ihtA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ihtA
Domain Number 1 Region: 380-565
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.35e-46
Family Pyruvate oxidase and decarboxylase PP module 0.0000000203
Further Details:      
 
Domain Number 2 Region: 9-185
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.03e-38
Family Pyruvate oxidase and decarboxylase Pyr module 0.000000047
Further Details:      
 
Domain Number 3 Region: 202-353
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.12e-32
Family Pyruvate oxidase and decarboxylase, middle domain 0.00000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ihtA   PDB: 2iht
Sequence length 573
Comment (A:)
Sequence
MSRVSTAPSGKPTAAHALLSRLRDHGVGKVFGVVGREAASILFDEVEGIDFVLTRHEFTA
GVAADVLARITGRPQACWATLGPGMTNLSTGIATSVLDRSPVIALAAQSESHDIFPNDTH
QCLDSVAIVAPMSKYAVELQRPHEITDLVDSAVNAAMTEPVGPSFISLPVDLLGSSEGID
TTVPNPPANTPAKPVGVVADGWQKAADQAAALLAEAKHPVLVVGAAAIRSGAVPAIRALA
ERLNIPVITTYIAKGVLPVGHELNYGAVTGYMDGILNFPALQTMFAPVDLVLTVGYDYAE
DLRPSMWQKGIEKKTVRISPTVNPIPRVYRPDVDVVTDVLAFVEHFETATASFGAKQRHD
IEPLRARIAEFLADPETYEDGMRVHQVIDSMNTVMEEAAEPGEGTIVSDIGFFRHYGVLF
ARADQPFGFLTSAGCSSFGYGIPAAIGAQMARPDQPTFLIAGDGGFHSNSSDLETIARLN
LPIVTVVVNNDTNGLIELYQNIGHHRSHDPAVKFGGVDFVALAEANGVDATRATNREELL
AALRKGAELGRPFLIEVPVNYDFQPGGFGALSI
Download sequence
Identical sequences B5GLC6 Q9LCV9
2ihtA 1upa_A 1upa_B 1upa_C 1upa_D 1upb_A 1upb_B 1upb_C 1upb_D 1upc_A 1upc_B 1upc_C 1upc_D 1upc_E 1upc_F 2iht_A 2iht_B 2iht_C 2iht_D 2ihu_A 2ihu_B 2ihu_C 2ihu_D 2ihv_A 2ihv_B 2ihv_C 2ihv_D WP_003952509.1.11688 WP_003952509.1.2818 WP_003952509.1.6963 WP_003952509.1.96813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]