SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2imhA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2imhA
Domain Number 1 Region: 3-228
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 8.1e-61
Family SPO2555-like 0.000000000768
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2imhA   PDB: 2imh
Sequence length 231
Comment (A:)
Sequence
msltfsilahdpetgaiggaaatgslcvggwvlrgdlnagmsasqgaapstfwgeevlqh
lrdgshpedavnhvtsqdsgrayrqlaamdllgnaaaftgsenqdikgsvtfasgiasgn
mlgdnsvlgamteafvasdltferrllaaliaaegagsdfrgllsaamlvlhpdrppvtl
ridyhpdnpigaleqlyqkattgdyadwarqvpvlsdkerildeghhhhhh
Download sequence
Identical sequences 2imhA 2imh_A 2imh_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]