SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2iu5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2iu5A
Domain Number 1 Region: 79-187
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 1.69e-68
Family Tetracyclin repressor-like, C-terminal domain 0.000000617
Further Details:      
 
Domain Number 2 Region: 9-74
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000316
Family Tetracyclin repressor-like, N-terminal domain 0.0000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2iu5A   PDB: 2iu5
Sequence length 195
Comment (A:)
Sequence
msafflnmeksiitqkiiakafkdlmqsnayhqisvsdimqtakirrqtfynyfqnqeel
lswifendfaelindnsdyygwqnelllllryldenqifyqkifvidknfehffliqwen
lldkvifdqekksdyhwsdleksficrynaaaicaitresiirgnsleklysqivnllla
qikifeslehhhhhh
Download sequence
Identical sequences cath|current|2iu5A00/1-180 cath|current|2iu5B00/4-181 2iu5_A 2iu5_B 2iu5A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]