SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2iw5B from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2iw5B
Domain Number 1 Region: 135-177
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000347
Family Myb/SANT domain 0.0014
Further Details:      
 
Domain Number 2 Region: 3-37
Classification Level Classification E-value
Superfamily PDB 0.00000000913
Family PDB 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2iw5B   PDB: 2iw5
Sequence length 235
Comment (B:)
Sequence
mgsshhhhhhssglvprgshmasmtggqqmgrgsefgrptetvpqvkkekhstqaknrak
rkppkgmflsqedveavsanataattvlrqldmelvsvkrqiqnikqtnsalkekldggi
epyrlpeviqkcnarwtteeqllavqairkygrdfqaisdvignksvvqvknffvnyrrr
fnidevlqeweaehgkeetngpsnqkpvkspdnsikmpeeedeapvldvryasas
Download sequence
Identical sequences 2iw5B 2iw5_B 2uxn_B 2uxx_B 4kum_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]