SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2j011 from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2j011
Domain Number 1 Region: 1-95
Classification Level Classification E-value
Superfamily L28p-like 7.91e-19
Family Ribosomal protein L28 0.0000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2j011   PDB: 2j01
Sequence length 98
Comment (1:)
Sequence
MSKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVAGQEITF
RVAASHIPKVYELVERAKGLKLEGLSPKEIKKELLKLL
Download sequence
Identical sequences F6DDM4 H7GED4 H9ZTF0 P60494
gi|386361151|ref|YP_006059396.1| 300852.TTHA0042 2j011 WP_008631133.1.25090 WP_008631133.1.52262 WP_008631133.1.60518 WP_008631133.1.65589 WP_008631133.1.96068 YP_143308.1.19876 gi|384430543|ref|YP_005639903.1| 000147620|e3uxq11|4232.1.1.6|1:1-98 000148867|e3uyeZ1|4232.1.1.6|Z:1-98 000150175|e3v2311|4232.1.1.6|1:1-98 1vvj_R1 1vvj_Y1 1vy4_B1 1vy4_D1 1vy5_B1 1vy5_D1 1vy6_B1 1vy6_D1 1vy7_B1 1vy7_D1 4l47_R1 4l47_Y1 4l71_R1 4l71_Y1 4lel_R1 4lel_Y1 4lfz_R1 4lfz_Y1 4lnt_R1 4lnt_Y1 4lsk_R1 4lsk_Y1 4lt8_R1 4lt8_Y1 4p6f_R1 4p6f_Y1 4p70_R1 4p70_Y1 4tua_R1 4tua_Y1 4tub_R1 4tub_Y1 4tuc_R1 4tuc_Y1 4tud_R1 4tud_Y1 4tue_R1 4tue_Y1 4v51_B1 4v51_D1 4v5a_B1 4v5a_D1 4v5c_B1 4v5c_D1 4v5d_B1 4v5d_D1 4v5e_B1 4v5e_D1 4v5f_B1 4v5f_D1 4v5g_B1 4v5g_D1 4v5j_B1 4v5j_D1 4v5l_B1 4v5m_B1 4v5n_B1 4v5p_B1 4v5p_D1 4v5q_B1 4v5q_D1 4v5r_B1 4v5r_D1 4v5s_B1 4v5s_D1 4v6a_B1 4v6a_D1 4v6f_AZ 4v6f_DZ 4v6g_BZ 4v6g_DZ 4v7j_A1 4v7j_B1 4v7k_A1 4v7k_B1 4v7l_B1 4v7l_D1 4v7m_B1 4v7m_D1 4v7w_B1 4v7w_D1 4v7x_B1 4v7x_D1 4v7y_B1 4v7y_D1 4v7z_B1 4v7z_D1 4v8a_A1 4v8a_B1 4v8b_BZ 4v8b_DZ 4v8c_AZ 4v8c_BZ 4v8d_BZ 4v8d_DZ 4v8e_AZ 4v8e_CZ 4v8f_AZ 4v8f_DZ 4v8g_B1 4v8g_D1 4v8h_B1 4v8h_D1 4v8i_B1 4v8i_D1 4v8j_B1 4v8j_D1 4v8o_B1 4v8q_A1 4v8u_B1 4v8u_D1 4v8x_B1 4v8x_D1 4v95_B1 4v95_D1 4v97_B1 4v97_D1 4v9a_BZ 4v9a_DZ 4v9b_BZ 4v9b_DZ 4v9h_B1 4v9r_B1 4v9r_D1 4v9s_B1 4v9s_D1 4w2e_1 4w2f_B1 4w2f_D1 4w2g_B1 4w2g_D1 4w2h_B1 4w2h_D1 4w2i_B1 4w2i_D1 4w4g_R1 4w4g_Y1 4wpo_A1 4wpo_C1 4wq1_F5 4wq1_J8 4wqf_A1 4wqf_C1 4wqr_F5 4wqr_J8 4wqu_A1 4wqu_C1 4wqy_A1 4wqy_C1 4wr6_F5 4wr6_J8 4wra_F5 4wra_J8 4wro_J8 4wsd_F5 4wsd_J8 4wsm_F5 4wsm_J8 4wt1_F5 4wt1_J8 4wu1_F5 4wu1_J8 4wzd_F5 4wzd_J8 4wzo_F5 4wzo_J8 4y4o_11 4y4o_21 4y4p_11 4y4p_21 4ypb_R1 4ypb_Y1 4yzv_R1 4yzv_Y1 4z3s_11 4z3s_21 4z8c_11 4z8c_21 4zsn_R1 4zsn_Y1 5czp_R1 5czp_Y1 5dfe_R1 5dfe_Y1 5dox_11 5dox_21 5doy_11 5doy_21 5e7k_F5 5e7k_J8 5e81_F5 5e81_J8 5el4_F5 5el4_J8 5el5_F5 5el5_J8 5el6_F5 5el6_J8 5el7_F5 5el7_J8 5hau_1Z 5hau_2Z 5hcp_11 5hcp_21 5hcq_11 5hcq_21 5hcr_11 5hcr_21 5hd1_11 5hd1_21 5ib7_F5 5ib7_J8 5ib8_F5 5ib8_J8 5ibb_F5 5ibb_J8 5j30_R1 5j30_Y1 5j3c_R1 5j3c_Y1 5j4b_11 5j4b_21 5j4c_11 5j4c_21 5j8b_1 5ndj_F5 5ndj_J8 5ndk_F5 5ndk_J8 5vp2_11 5vp2_21 5vpo_R1 5vpo_Y1 5vpp_R1 5vpp_Y1 5w4k_11 5w4k_21 5wis_11 5wis_21 5wit_11 5wit_21 6c5l_B1 6c5l_D1 6cae_11 6cae_21 6cfj_11 6cfj_21 6cfk_11 6cfk_21 6cfl_11 6cfl_21 6gsj_F5 6gsj_J8 6gsk_F5 6gsk_J8 6gsl_F5 6gsl_J8 ttk003000827.1 gi|55980011|ref|YP_143308.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]