SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2j01S from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2j01S
Domain Number 1 Region: 6-110
Classification Level Classification E-value
Superfamily Translational machinery components 9.52e-49
Family Ribosomal protein L18 and S11 0.00000438
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2j01S   PDB: 2j01
Sequence length 112
Comment (S:)
Sequence
MARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKG
NKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREGGLEF
Download sequence
Identical sequences A0A1J1EJK5 F6DEN6 H7GHU1 H9ZPL8 P80320 Q5SHQ4 Q72I20
gi|386359819|ref|YP_006058064.1| gi|46199614|ref|YP_005281.1| 2j01S ttk003000818.1 1vvj_RS 1vvj_YS 1vy4_BS 1vy4_DS 1vy5_BS 1vy5_DS 1vy6_BS 1vy6_DS 1vy7_BS 1vy7_DS 4l47_RS 4l47_YS 4l71_RS 4l71_YS 4lel_RS 4lel_YS 4lfz_RS 4lfz_YS 4lnt_RS 4lnt_YS 4lsk_RS 4lsk_YS 4lt8_RS 4lt8_YS 4p6f_RS 4p6f_YS 4p70_RS 4p70_YS 4tua_RS 4tua_YS 4tub_RS 4tub_YS 4tuc_RS 4tuc_YS 4tud_RS 4tud_YS 4tue_RS 4tue_YS 4v4i_M 4v4j_M 4v4x_BR 4v4y_BR 4v4z_BR 4v51_BS 4v51_DS 4v5a_BS 4v5a_DS 4v5c_BS 4v5c_DS 4v5d_BS 4v5d_DS 4v5e_BS 4v5e_DS 4v5f_BS 4v5f_DS 4v5g_BS 4v5g_DS 4v5j_BS 4v5j_DS 4v5k_BS 4v5k_DS 4v5l_BS 4v5m_BS 4v5n_BS 4v5p_BS 4v5p_DS 4v5q_BS 4v5q_DS 4v5r_BS 4v5r_DS 4v5s_BS 4v5s_DS 4v63_BS 4v63_DS 4v67_BS 4v67_DS 4v6a_BS 4v6a_DS 4v6f_AQ 4v6f_DQ 4v6g_BQ 4v6g_DQ 4v7j_AS 4v7j_BS 4v7k_AS 4v7k_BS 4v7l_BS 4v7l_DS 4v7m_BS 4v7m_DS 4v7w_BS 4v7w_DS 4v7x_BS 4v7x_DS 4v7y_BS 4v7y_DS 4v7z_BS 4v7z_DS 4v8a_AS 4v8a_BS 4v8b_BQ 4v8b_DQ 4v8c_AQ 4v8c_BQ 4v8d_BQ 4v8d_DQ 4v8e_AQ 4v8e_CQ 4v8f_AQ 4v8f_DQ 4v8g_BS 4v8g_DS 4v8h_BS 4v8h_DS 4v8i_BS 4v8i_DS 4v8j_BS 4v8j_DS 4v8n_BS 4v8n_DS 4v8o_BS 4v8q_AS 4v8u_BS 4v8u_DS 4v8x_BS 4v8x_DS 4v95_BS 4v95_DS 4v97_BS 4v97_DS 4v9a_BQ 4v9a_DQ 4v9b_BQ 4v9b_DQ 4v9h_BS 4v9r_BS 4v9r_DS 4v9s_BS 4v9s_DS 4w2e_S 4w2f_BS 4w2f_DS 4w2g_BS 4w2g_DS 4w2h_BS 4w2h_DS 4w2i_BS 4w2i_DS 4w4g_RS 4w4g_YS 4wpo_AS 4wpo_CS 4wqf_AS 4wqf_CS 4wqr_65 4wqr_A8 4wqu_AS 4wqu_CS 4wqy_AS 4wqy_CS 4wr6_65 4wr6_A8 4wra_65 4wra_A8 4wro_A8 4wsd_65 4wsd_A8 4wsm_65 4wsm_A8 4wt1_65 4wt1_A8 4wu1_65 4wu1_A8 4wzd_65 4wzd_A8 4wzo_65 4wzo_A8 4y4o_1S 4y4o_2S 4y4p_1S 4y4p_2S 4ypb_RS 4ypb_YS 4yzv_RS 4yzv_YS 4z3s_1S 4z3s_2S 4z8c_1S 4z8c_2S 4zsn_RS 4zsn_YS 5czp_RS 5czp_YS 5d8b_IB 5d8b_M 5dfe_RS 5dfe_YS 5dox_1S 5dox_2S 5doy_1S 5doy_2S 5e7k_65 5e7k_A8 5e81_65 5e81_A8 5el4_65 5el4_A8 5el5_65 5el5_A8 5el6_65 5el6_A8 5el7_65 5el7_A8 5hau_1Q 5hau_2Q 5hcp_1S 5hcp_2S 5hcq_1S 5hcq_2S 5hcr_1S 5hcr_2S 5hd1_1S 5hd1_2S 5ib7_65 5ib7_A8 5ib8_65 5ib8_A8 5ibb_65 5ibb_A8 5imq_k 5imr_k 5j30_RS 5j30_YS 5j3c_RS 5j3c_YS 5j4b_1S 5j4b_2S 5j4c_1S 5j4c_2S 5j4d_P 5j4d_UB 5j8b_S 5ndj_65 5ndj_A8 5ndk_65 5ndk_A8 5v8i_1S 5v8i_2S 5vp2_1S 5vp2_2S 5vpo_RS 5vpo_YS 5vpp_RS 5vpp_YS 5w4k_1S 5w4k_2S 5wis_1S 5wis_2S 5wit_1S 5wit_2S 5zlu_l 6b4v_P 6b4v_TB 6boh_P 6boh_UB 6bok_P 6bok_SB 6c5l_BS 6c5l_DS 6cae_1S 6cae_2S 6cfj_1S 6cfj_2S 6cfk_1S 6cfk_2S 6cfl_1S 6cfl_2S 6gsj_65 6gsj_A8 6gsk_65 6gsk_A8 6gsl_65 6gsl_A8 WP_008633391.1.25090 WP_008633391.1.52262 WP_008633391.1.60518 WP_008633391.1.65589 WP_008633391.1.85415 WP_008633391.1.96068 YP_144942.1.19876 gi|55981645|ref|YP_144942.1| gi|384431856|ref|YP_005641216.1| 262724.TTC1312 300852.TTHA1676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]