SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2je6I from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2je6I
Domain Number 1 Region: 69-159
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.24e-20
Family Cold shock DNA-binding domain-like 0.0000148
Further Details:      
 
Domain Number 2 Region: 155-236
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000002
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000135
Further Details:      
 
Domain Number 3 Region: 10-67
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.000000000000041
Family ECR1 N-terminal domain-like 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2je6I   PDB: 2je6
Sequence length 251
Comment (I:)
Sequence
ghmnmsqsqeivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqf
eviplegsfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgedlrr
yldvgdyviarienfdrsidpvlsvkgkdlgrvsngividimpvkvprvigknksmyetl
tsksgcsifvanngriwatcpsrfseeilieairkieneshikgltdrikqfieeklger
nassgetktns
Download sequence
Identical sequences 2je6_I 2jea_I 4ba1_I 4ba2_I 2je6I

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]