SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ji7A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ji7A
Domain Number 1 Region: 11-184
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.07e-42
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000000263
Further Details:      
 
Domain Number 2 Region: 372-552
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.77e-40
Family Pyruvate oxidase and decarboxylase PP module 0.0000000224
Further Details:      
 
Domain Number 3 Region: 195-356
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 3e-39
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000000795
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ji7A   PDB: 2ji7
Sequence length 568
Comment (A:)
Sequence
MSNDDNVELTDGFHVLIDALKMNDIDTMYGVVGIPITNLARMWQDDGQRFYSFRHEQHAG
YAASIAGYIEGKPGVCLTVSAPGFLNGVTSLAHATTNCFPMILLSGSSEREIVDLQQGDY
EEMDQMNVARPHCKASFRINSIKDIPIGIARAVRTAVSGRPGGVYVDLPAKLFGQTISVE
EANKLLFKPIDPAPAQIPAEDAIARAADLIKNAKRPVIMLGKGAAYAQCDDEIRALVEET
GIPFLPMGMAKGLLPDNHPQSAAATRAFALAQCDVCVLIGARLNWLMQHGKGKTWGDELK
KYVQIDIQANEMDSNQPIAAPVVGDIKSAVSLLRKALKGAPKADAEWTGALKAKVDGNKA
KLAGKMTAETPSGMMNYSNSLGVVRDFMLANPDISLVNEGANALDNTRMIVDMLKPRKRL
DSGTWGVMGIGMGYCVAAAAVTGKPVIAVEGDSAFGFSGMELETICRYNLPVTVIIMNNG
GIYKGNEADPQPGVISCTRLTRGRYDMMMEAFGGKGYVANTPAELKAALEEAVASGKPCL
INAMIDPDAGVESGRIKSLNVVSKVGKK
Download sequence
Identical sequences A0A1W7BCC4 C3XBB9 P40149
2ji7A WP_005881708.1.59348 WP_005881708.1.87544 WP_005881708.1.96885 2c31_A 2c31_B 2ji6_A 2ji6_B 2ji7_A 2ji7_B 2ji8_A 2ji8_B 2ji9_A 2ji9_B 2jib_A 2jib_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]